This tool attempts to detect copyright violations in articles. In search mode, it will check for similar content elsewhere on the web using Google, external links present in the text of the page, or Turnitin (via EranBot), depending on which options are selected. In comparison mode, the tool will compare the article to a specific webpage without making additional searches, like the Duplication Detector.
Running a full check can take up to a minute if other websites are slow or if the tool is under heavy use. Please be patient. If you get a timeout, wait a moment and refresh the page.
Be aware that other websites can copy from Wikipedia, so check the results carefully, especially for older or well-developed articles. Specific websites can be skipped by adding them to the excluded URL list.
Article: The Ascidian Mitochondrial Code (transl_table=13)
Code AAs = FFLLSSSSYY**CCWWLLLLPPPPHHQQRRRRIIMMTTTTNNKKSSGGVVVVAAAADDEEGGGG Starts = ---M------------------------------MM---------------M------------ Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG
Click here to change format
Differences from the standard code
Code 13 Standard AGA Gly Arg AGG Gly Arg AUA Met Ile UGA Trp Ter
Systematic range and comments
There is evidence from a phylogenetically diverse sample of tunicates (Urochordata) that AGA and AGG code for glycine. In other organisms, AGA/AGG code for either arginine or serine and in vertebrate mitochondria they code a STOP. Evidence for glycine translation of AGA/AGG has been found in Pyura stolonifera{pubmed}10352185{pubmed}Kondow et al. 1999{pubmed}8381878{pubmed}Yokobori et al., 1993{pubmed}10581290{pubmed}Yokobori et al. 1999/Taxonomy/Browser/wwwtax.cgi?name=Ciona+savignyiCiona savignyi{pubmed}14738316{pubmed}Yokobori et al. 2003/Taxonomy/Browser/wwwtax.cgi?name=Halocynthia+roretziHalocynthia roretzihttp://www.ncbi.nlm.nih.gov/genomes/framik.cgi?db=genome&gi=15273mitochondrial genome{pubmed}10352185{pubmed}Kondow et al. 1999{pubmed}10581290{pubmed}Yokobori et al. 1999
Alternative initiation codons
ATA, GTG and TTG (Yokobori et al. 1999).
ATT is the start codon for the CytB gene in Halocynthia roretzi (Gissi and Pesole, 2003).
See also
List of genetic codes
References
This article contains public domain text from the NCBI page compiled by Andrzej (Anjay) Elzanowski and Jim Ostell.
External links |
Source: Skip to main content
An official website of the United States government
Here's how you know
The .gov means it’s official.
Federal government websites often end in .gov or .mil. Before
sharing sensitive information, make sure you’re on a federal
government site.
The site is secure.
The https://
ensures that you are connecting to the
official website and that any information you provide is encrypted
and transmitted securely. 400 bad request
Sorry, something went wrong. Please try again later.
Try one of these options instead:
NCBI Home Contact Help Desk Search Follow NCBI Twitter Facebook LinkedIn GitHub Connect with NLM SM-Twitter SM-Facebook SM-Youtube
National Library of Medicine
8600 Rockville Pike Bethesda, MD 20894 Web Policies FOIA HHS Vulnerability Disclosure Help Accessibility Careers NLM NIH HHS USA.gov |