Search for free images to add to Wikipedia articles, or replace non-free images and placeholders.
Scan . .org
To the left are (one line each):
( subcategories deep)


[slooow]
( ×) [slooow]

Start at
Image
sources







Note : No thumbnails available; click on the icons

Note : GIMP-SAVVY blocks most thumbnail requests.

List

images
these categories




Default thumbnail size is px
Find
Results as
Potential images have to be at least
× pixels in size
Color codes :
Image from commons (free license)
Free license or public domain
Unknown copyright status
Non-free image (copyvio, fair use, etc.)
Image from flickr (CC-BY/-SA license)
Image from GIMP-SAVVY (public domain)
Copy the URL of this link to get a pre-filled search for the values you have entered above.
Retrieving article list ... 1 articles found. Searching for images will take time, please be patient...
Bill Campbell (empresário)
[edit]
(has no images)
Images used in other wikipedias (from the respective wikipedias or from Wikimedia Commons)
William C. Campbell 4983-1-2015.jpg on commons.wikimedia; 2335×2335px, 5028733 bytes
Used on ar, azb, fr, ro.
[[File:William C. Campbell 4983-1-2015.jpg|thumb|250px|William C. Campbell 4983-1-2015.]]
Flickr (search flickr manually)
Bill Campbell (empresário)
Upload to Commons with flinfo or Bryan's upload tool

Tags : catherine село дворец пушкин павловск царское palaceекатерининский thecatherinepalacerussianекатерининскийдворецwastherococosummerresidenceoftherussiantsarslocatedinthetownoftsarskoyeselopushkin25kmsoutheastofstpetersburgrussiatheresidenceoriginatedin1717whencatherineiof butitwastheworkofpenelopewhatwasdonetoday wasdestroyedtomorrowthathousehasbeenpulleddownsixtimestothefoundation thenbuiltupagainereitwasbroughttoitspresentstatethesumofamillionsixhundredthousandrubleswasspentontheconstructionaccountsexisttoproveitbutbesidesthissumtheempressspentmuchmoneyoutofherownpocketonit withoutevercountinginordertogratifyherpassionforantiqueandneoclassicalartcatherineemployedthescottisharchitectcharlescameronwhonotonlyrefurbishedtheinteriorofonewingintheneopalladianstyletheninvoguebutalsoconstru
Bill Campbell (empresário)
Upload to Commons with flinfo or Bryan's upload tool

Tags : bookcentury1900 bookdecade1900 bookidiris1905ward bookyear1905 bookauthorwardseminary18651913 booksubjectschoolyearbookstennesseenashville booksubjectwardseminarynashvilletennperiodicals booksubjectgirlsschoolstennesseenashville booksubjecteducationprimarytennesseenashville booksubjecteducationelementarytennesseenashville booksubjecteducationsecondarytennesseenashville booksubjectcollegepreparatoryschoolstennesseenashville booksubjectjuniorcollegestennesseenashville booksubjectboardingschoolstennesseenashville booksubjectwomenscollegestennesseenashville booksubjectwomeneducationtennesseenashville18651951 bookpublisherwardseminary bookleafnumber48 bookcollectionamericana booksponsorlyrasismembersandsloanfoundation bookcontributorharpethhallschool bookcollectionharpethhall
Bill Campbell (empresário)
Upload to Commons with flinfo or Bryan's upload tool

Tags : blinkagain
Bill Campbell (empresário)
Upload to Commons with flinfo or Bryan's upload tool

Tags : larusnovaehollandiaescopulinus redbilledgullsnz seabirds lumixfz1000 nature gulls
Bill Campbell (empresário)
Upload to Commons with flinfo or Bryan's upload tool

Tags : newyork sports sport canon football championship buffalo buffalobills mac university nike canonrebel ub ncaa bowlinggreen universityatbuffalo ralphwilsonstadium unviersity buffalobulls canonrebelt5i

All done! (17.527268886566sec)