Search for free images to add to Wikipedia articles, or replace non-free images and placeholders.
Scan . .org
To the left are (one line each):
( subcategories deep)


[slooow]
( ×) [slooow]

Start at
Image
sources







Note : No thumbnails available; click on the icons

Note : GIMP-SAVVY blocks most thumbnail requests.

List

images
these categories




Default thumbnail size is px
Find
Results as
Potential images have to be at least
× pixels in size
Color codes :
Image from commons (free license)
Free license or public domain
Unknown copyright status
Non-free image (copyvio, fair use, etc.)
Image from flickr (CC-BY/-SA license)
Image from GIMP-SAVVY (public domain)
Copy the URL of this link to get a pre-filled search for the values you have entered above.
Retrieving article list ... 1 articles found. Searching for images will take time, please be patient...
Joseph Losey
[edit]
(has no images)
Wikimedia Commons (Search Commons for Joseph Losey)
Joseph Losey 1965 (crop).png
[[File:Joseph Losey 1965 (crop).png|thumb|250px|Joseph Losey 1965 (crop).png]]
Joseph Losey 1965.jpg
[[File:Joseph Losey 1965.jpg|thumb|250px|Joseph Losey 1965.jpg]]
Joseph Losey film director lived here between 1966 and 1984.jpg
[[File:Joseph Losey film director lived here between 1966 and 1984.jpg|thumb|250px|Joseph Losey film director lived here between 1966 and 1984.jpg]]
Images used in other wikipedias (from the respective wikipedias or from Wikimedia Commons)
Joseph Losey 1965.jpg on commons.wikimedia; 810×1509px, 344069 bytes
Used on bg, ca, da, de, en, es, eu, fa, fi, fr, gl, he, hu, it, ja, ko, lb, mg, nl, no, pl, ro, ru, sh, sv, uk.
[[File:Joseph Losey 1965.jpg|thumb|250px|Joseph Losey 1965.]]
LoseyArch.JPG on commons.wikimedia; 3456×2304px, 2955676 bytes
Used on en.
[[File:LoseyArch.JPG|thumb|250px|LoseyArch.]]
Blue pencil RTL.svg on commons.wikimedia; 600×600px, 2323 bytes
Used on he.
[[File:Blue pencil RTL.svg|thumb|250px|Blue pencil RTL.]]
Searchtool.svg on commons.wikimedia; 512×512px, 5677 bytes
Used on uk.
[[File:Searchtool.svg|thumb|250px|Searchtool.]]
Terence Stamp, Monica Vitti and Joseph Losey 1965b.jpg on commons.wikimedia; 2122×1953px, 987077 bytes
Used on uk.
[[File:Terence Stamp, Monica Vitti and Joseph Losey 1965b.jpg|thumb|250px|Terence Stamp, Monica Vitti and Joseph Losey 1965b.]]
Flickr (search flickr manually)
Joseph Losey
Upload to Commons with flinfo or Bryan's upload tool

Tags : england clock film movie harbour jubilee location dorset damned josephlosey weymourth
Joseph Losey
Upload to Commons with flinfo or Bryan's upload tool

Tags : england london film chelsea servant royalcrescent sarahmiles jamesfox dirkbogarde josephlosey
Joseph Losey
Upload to Commons with flinfo or Bryan's upload tool

Tags : chelsea
Joseph Losey
Upload to Commons with flinfo or Bryan's upload tool

Tags : england london film movie chelsea servant kingsroad losey bogarde
Joseph Losey
Upload to Commons with flinfo or Bryan's upload tool

Tags : africa kenya civilaffairs nmcb74 cjtfhoa mandabay africom civilmilitaryoperations melaniemcbride stephenfrazier usafricacommand usarmyafrica usaraf armyafrica brianlosey 402ndcivilaffairsfunctionalspecialtyteam kenyanministryofdefense kenyanarmyengineerscivilaffairsteam 12thheadquartersengineerbrigade combinedjointtaskforce–hornofafrica stephencharo josephgilong kautharaprimaryschool mcat208 davidkwendo

All done! (44.200543880463sec)