Search for free images to add to Wikipedia articles, or replace non-free images and placeholders.
Scan . .org
To the left are (one line each):
( subcategories deep)

( ×) [slooow]

Start at

Note : No thumbnails available; click on the icons

Note : GIMP-SAVVY blocks most thumbnail requests.


these categories

Default thumbnail size is px
Results as
Potential images have to be at least
× pixels in size
Color codes :
Image from commons (free license)
Free license or public domain
Unknown copyright status
Non-free image (copyvio, fair use, etc.)
Image from flickr (CC-BY/-SA license)
Image from GIMP-SAVVY (public domain)
Copy the URL of this link to get a pre-filled search for the values you have entered above.
Retrieving article list ... 1 articles found. Searching for images will take time, please be patient...
Mug Martins
(has no images)
Flickr (search flickr manually)
Mug Martins
Upload to Commons with flinfo or Bryan's upload tool

Tags : poppyseedssunnyislesbeachlendersbagelslendersbagelbakerymurraylenderharrylendermarvinlendersamlenderpinnaclefoodskraftfoodsaurorafoodskelloggsthelenderfamilybagelsnfranationalfrozenrefrigeratedfoodsassociation incfamilybusinessonlyinamericaentrepreneurharrylenderimmigrantssuccessstoryfrozenfoodsbakerybakedgoodspizzabagelssam murrayandmarvinhlendersons
Mug Martins
Upload to Commons with flinfo or Bryan's upload tool

Tags : 1996 22917 bird england island july1996 sv9216 scillyisles songthrush stmartins turdusphilomelos middletown unitedkingdom gb
Mug Martins
Upload to Commons with flinfo or Bryan's upload tool

Tags : bookcentury1900 bookdecade1900 bookyear1906 bookidhistoryofprincet00prin bookauthorprincetonuniversityclassof1896 bookpublishernewyorkpressoffpmcbreenco bookcontributorthelibraryofcongress bookcollectionamericana booksponsorthelibraryofcongress bookleafnumber91 bookcollectionlibraryofcongress
Mug Martins
Upload to Commons with flinfo or Bryan's upload tool

Tags :
Mug Martins
Upload to Commons with flinfo or Bryan's upload tool

Tags : martin mckeay
No language links. Google-search other wikipedias for this.

All done! (1.1018931865692sec)