Search for free images to add to Wikipedia articles, or replace non-free images and placeholders.
Scan . .org
To the left are (one line each):
( subcategories deep)

( ×) [slooow]

Start at

Note : No thumbnails available; click on the icons

Note : GIMP-SAVVY blocks most thumbnail requests.


these categories

Default thumbnail size is px
Results as
Potential images have to be at least
× pixels in size
Color codes :
Image from commons (free license)
Free license or public domain
Unknown copyright status
Non-free image (copyvio, fair use, etc.)
Image from flickr (CC-BY/-SA license)
Image from GIMP-SAVVY (public domain)
Copy the URL of this link to get a pre-filled search for the values you have entered above.
Retrieving article list ... 1 articles found. Searching for images will take time, please be patient...
Peterson Rosa
(has no images)
Flickr (search flickr manually)
Peterson Rosa
Upload to Commons with flinfo or Bryan's upload tool

Tags : bookcentury1800 booksubjecthorses bookdecade1880 bookyear1882 bookpublishersanfranciscocalifsn bookidbreedersportsma501907sanf bookleafnumber146 bookcollectionamericana bookcontributorsanfranciscopubliclibrary bhlcollection booksponsorcaliforniastatelibrarycalifalstagrant
Peterson Rosa
Upload to Commons with flinfo or Bryan's upload tool

Tags :
Peterson Rosa
Upload to Commons with flinfo or Bryan's upload tool

Tags : bookcentury1900 bookdecade1900 bookyear1906 bookauthorwardseminary18651913 booksubjectschoolyearbookstennesseenashville booksubjectwardseminarynashvilletennperiodicals booksubjectgirlsschoolstennesseenashville booksubjecteducationprimarytennesseenashville booksubjecteducationelementarytennesseenashville booksubjecteducationsecondarytennesseenashville booksubjectcollegepreparatoryschoolstennesseenashville booksubjectjuniorcollegestennesseenashville booksubjectboardingschoolstennesseenashville booksubjectwomenscollegestennesseenashville booksubjectwomeneducationtennesseenashville18651951 bookpublisherwardseminary bookidiris1906ward bookcollectionamericana booksponsorlyrasismembersandsloanfoundation bookleafnumber214 bookcontributorharpethhallschool bookcollectionharpethhall
Peterson Rosa
Upload to Commons with flinfo or Bryan's upload tool

Tags : bookcentury1900 booksubjectmentalillness booksubjectnervoussystem bookdecade1910 bookyear1919 bookpublisherphiladelphialondonwbsaunderscompany bookauthorpetersonfrederick18591938jointauthor bookauthorchurcharchibaldb1861 bookidnervousmentaldis00chu bookcontributorthelibraryofcongress bookcollectionamericana booksponsorthelibraryofcongress bookcollectionlibraryofcongress bookleafnumber409
Peterson Rosa
Upload to Commons with flinfo or Bryan's upload tool

Tags : bookcentury1800 bookdecade1850 bookidbrazilbrazilians00kidd bookauthorkidderdanielpdanielparish18151891 bookauthorfletcherjamescjamescooley18231901 bookpublisherphiladelphiachildspeterson bookyear1857 bookpublisherbostonphillipssampsonco bookcollectionamericana bookleafnumber377 booksponsorinternetarchive bookcontributorbostonpubliclibrary bookcollectionbostonpubliclibrary
Searched for images in fr - no suitable ones found.

All done! (2.8771708011627sec)