Search for free images to add to Wikipedia articles, or replace non-free images and placeholders.
Scan . .org
To the left are (one line each):
( subcategories deep)

( ×) [slooow]

Start at

Note : No thumbnails available; click on the icons

Note : GIMP-SAVVY blocks most thumbnail requests.


these categories

Default thumbnail size is px
Results as
Potential images have to be at least
× pixels in size
Color codes :
Image from commons (free license)
Free license or public domain
Unknown copyright status
Non-free image (copyvio, fair use, etc.)
Image from flickr (CC-BY/-SA license)
Image from GIMP-SAVVY (public domain)
Copy the URL of this link to get a pre-filled search for the values you have entered above.
Retrieving article list ... 1 articles found. Searching for images will take time, please be patient...
The Calcium Kid
(has no images)
Flickr (search flickr manually)
The Calcium Kid
Upload to Commons with flinfo or Bryan's upload tool

Tags : bookcentury1800 bookdecade1880 bookidladieshomejourna65janwyet bookauthorwyethncnewellconvers18821945 booksubjectwomensperiodicals booksubjectjanicebluesteinlongoneculinaryarchive bookyear1889 bookpublisherphiladelphiasn bookcontributorinternetarchive bookcollectioninternetarchivebooks bookleafnumber1212 bookcollectionchina booksponsorinternetarchive
The Calcium Kid
Upload to Commons with flinfo or Bryan's upload tool

Tags : poppyseedssunnyislesbeachlendersbagelslendersbagelbakerymurraylenderharrylendermarvinlendersamlenderpinnaclefoodskraftfoodsaurorafoodskelloggsthelenderfamilybagelsnfranationalfrozenrefrigeratedfoodsassociation incfamilybusinessonlyinamericaentrepreneurharrylenderimmigrantssuccessstoryfrozenfoodsbakerybakedgoodspizzabagelssam murrayandmarvinhlendersons
The Calcium Kid
Upload to Commons with flinfo or Bryan's upload tool

Tags : seattle ca washington cafe iron pacific center calcium science fe
The Calcium Kid
Upload to Commons with flinfo or Bryan's upload tool

Tags : bookcentury1800 bookdecade1880 bookidladieshomejourna65janwyet bookauthorwyethncnewellconvers18821945 booksubjectwomensperiodicals booksubjectjanicebluesteinlongoneculinaryarchive bookyear1889 bookpublisherphiladelphiasn bookcontributorinternetarchive bookcollectioninternetarchivebooks bookleafnumber1212 bookcollectionchina booksponsorinternetarchive
The Calcium Kid
Upload to Commons with flinfo or Bryan's upload tool

Tags : nature stalactites crystalcave calciumcarbonate sequoianationalparkcalifornia caveinteriors
Searched for images in da, de, en, es, fi, fr, hu, it, no, pl, ru, sv - no suitable ones found.

All done! (4.4620571136475sec)